Anti RTKN2 pAb (ATL-HPA037946 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA037946-25

Protein Description: rhotekin 2
Gene Name: RTKN2
Alternative Gene Name: bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037846: 80%, ENSRNOG00000000636: 78%
Entrez Gene ID: 219790
Uniprot ID: Q8IZC4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSA
• Gene Sequence: GANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSA
• Gene ID - Mouse: ENSMUSG00000037846
• Gene ID - Rat: ENSRNOG00000000636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RTKN2 pAb (ATL-HPA037946 w/enhanced validation) – 1 Found

Steele, Mark P; Luna, Leah G; Coldren, Christopher D; Murphy, Elissa; Hennessy, Corinne E; Heinz, David; Evans, Christopher M; Groshong, Steve; Cool, Carlyne; Cosgrove, Gregory P; Brown, Kevin K; Fingerlin, Tasha E; Schwarz, Marvin I; Schwartz, David A; Yang, Ivana V. Relationship between gene expression and lung function in Idiopathic Interstitial Pneumonias. Bmc Genomics. 2015;16( 26503507):869.