Anti RTF1 pAb (ATL-HPA006714)

Atlas Antibodies

Catalog No.:
ATL-HPA006714-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Rtf1, Paf1/RNA polymerase II complex component, homolog (S. cerevisiae)
Gene Name: RTF1
Alternative Gene Name: KIAA0252
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027304: 100%, ENSRNOG00000005183: 99%
Entrez Gene ID: 23168
Uniprot ID: Q92541
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQL
Gene Sequence GNHNSKPVYRVAEITGVVETAKVYQLGGTRTNKGLQLRHGNDQRVFRLEFVSNQEFTESEFMKWKEAMFSAGMQLPTLDEINKKELSIKEALNYKFNDQDIEEIVKEKERFRKAPPNYAMKKTQL
Gene ID - Mouse ENSMUSG00000027304
Gene ID - Rat ENSRNOG00000005183
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTF1 pAb (ATL-HPA006714)
Datasheet Anti RTF1 pAb (ATL-HPA006714) Datasheet (External Link)
Vendor Page Anti RTF1 pAb (ATL-HPA006714) at Atlas Antibodies

Documents & Links for Anti RTF1 pAb (ATL-HPA006714)
Datasheet Anti RTF1 pAb (ATL-HPA006714) Datasheet (External Link)
Vendor Page Anti RTF1 pAb (ATL-HPA006714)