Anti RTCA pAb (ATL-HPA028151)

Atlas Antibodies

Catalog No.:
ATL-HPA028151-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RNA 3'-terminal phosphate cyclase
Gene Name: RTCA
Alternative Gene Name: RPC, RTC1, RTCD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000339: 94%, ENSRNOG00000014575: 95%
Entrez Gene ID: 8634
Uniprot ID: O00442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCV
Gene Sequence PLRVQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIKGGIHTADTKTAGSVCLLMQVSMPCV
Gene ID - Mouse ENSMUSG00000000339
Gene ID - Rat ENSRNOG00000014575
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RTCA pAb (ATL-HPA028151)
Datasheet Anti RTCA pAb (ATL-HPA028151) Datasheet (External Link)
Vendor Page Anti RTCA pAb (ATL-HPA028151) at Atlas Antibodies

Documents & Links for Anti RTCA pAb (ATL-HPA028151)
Datasheet Anti RTCA pAb (ATL-HPA028151) Datasheet (External Link)
Vendor Page Anti RTCA pAb (ATL-HPA028151)