Anti RTCA pAb (ATL-HPA027990 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA027990-25

Protein Description: RNA 3'-terminal phosphate cyclase
Gene Name: RTCA
Alternative Gene Name: RPC, RTC1, RTCD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000339: 87%, ENSRNOG00000014575: 87%
Entrez Gene ID: 8634
Uniprot ID: O00442
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL
• Gene Sequence: LLANLRHGGTVDEYLQDQLIVFMALANGVSRIKTGPVTLHTQTAIHFAEQIAKAKFIVKKSEDEEDAAKDTYIIECQGIGMTNPNL
• Gene ID - Mouse: ENSMUSG00000000339
• Gene ID - Rat: ENSRNOG00000014575
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.