Anti RSPH9 pAb (ATL-HPA031703 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031703-25

Protein Description: radial spoke head 9 homolog (Chlamydomonas)
Gene Name: RSPH9
Alternative Gene Name: C6orf206, CILD12, FLJ30845, MRPS18AL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023966: 89%, ENSRNOG00000019474: 87%
Entrez Gene ID: 221421
Uniprot ID: Q9H1X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
• Gene Sequence: SSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSY
• Gene ID - Mouse: ENSMUSG00000023966
• Gene ID - Rat: ENSRNOG00000019474
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RSPH9 pAb (ATL-HPA031703 w/enhanced validation) – 10 Found

Frommer, Adrien; Hjeij, Rim; Loges, Niki T; Edelbusch, Christine; Jahnke, Charlotte; Raidt, Johanna; Werner, Claudius; Wallmeier, Julia; Große-Onnebrink, Jörg; Olbrich, Heike; Cindrić, Sandra; Jaspers, Martine; Boon, Mieke; Memari, Yasin; Durbin, Richard; Kolb-Kokocinski, Anja; Sauer, Sascha; Marthin, June K; Nielsen, Kim G; Amirav, Israel; Elias, Nael; Kerem, Eitan; Shoseyov, David; Haeffner, Karsten; Omran, Heymut. Immunofluorescence Analysis and Diagnosis of Primary Ciliary Dyskinesia with Radial Spoke Defects. American Journal Of Respiratory Cell And Molecular Biology. 2015;53(4):563-73. 

Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. 

Sedykh, Irina; Keller, Abigail N; Yoon, Baul; Roberson, Laura; Moskvin, Oleg V; Grinblat, Yevgenya. Zebrafish Rfx4 controls dorsal and ventral midline formation in the neural tube. Developmental Dynamics : An Official Publication Of The American Association Of Anatomists. 2018;247(4):650-659. 

Narita, Keishi; Kozuka-Hata, Hiroko; Nonami, Yuta; Ao-Kondo, Hiroko; Suzuki, Toshimitsu; Nakamura, Hideki; Yamakawa, Kazuhiro; Oyama, Masaaki; Inoue, Takafumi; Takeda, Sen. Proteomic analysis of multiple primary cilia reveals a novel mode of ciliary development in mammals. Biology Open. 2012;1(8):815-25. 

Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. 

Sedykh, Irina; TeSlaa, Jessica J; Tatarsky, Rose L; Keller, Abigail N; Toops, Kimberly A; Lakkaraju, Aparna; Nyholm, Molly K; Wolman, Marc A; Grinblat, Yevgenya. Novel roles for the radial spoke head protein 9 in neural and neurosensory cilia. Scientific Reports. 2016;6( 27687975):34437. 

Abbasi, Ferheen; Miyata, Haruhiko; Shimada, Keisuke; Morohoshi, Akane; Nozawa, Kaori; Matsumura, Takafumi; Xu, Zoulan; Pratiwi, Putri; Ikawa, Masahito. RSPH6A is required for sperm flagellum formation and male fertility in mice. Journal Of Cell Science. 2018;131(19) 

Miyata, Haruhiko; Shimada, Keisuke; Morohoshi, Akane; Oura, Seiya; Matsumura, Takafumi; Xu, Zoulan; Oyama, Yuki; Ikawa, Masahito. Testis-enriched kinesin KIF9 is important for progressive motility in mouse spermatozoa. Faseb Journal : Official Publication Of The Federation Of American Societies For Experimental Biology. 2020;34(4):5389-5400. 

Liu, Zhen; Nguyen, Quynh P H; Guan, Qingxu; Albulescu, Alexandra; Erdman, Lauren; Mahdaviyeh, Yasaman; Kang, Jasmine; Ouyang, Hong; Hegele, Richard G; Moraes, Theo; Goldenberg, Anna; Dell, Sharon D; Mennella, Vito. A quantitative super-resolution imaging toolbox for diagnosis of motile ciliopathies. Science Translational Medicine. 2020;12(535) 

Yoke, Hiroshi; Ueno, Hironori; Narita, Akihiro; Sakai, Takafumi; Horiuchi, Kahoru; Shingyoji, Chikako; Hamada, Hiroshi; Shinohara, Kyosuke. Rsph4a is essential for the triplet radial spoke head assembly of the mouse motile cilia. Plos Genetics. 2020;16(3):e1008664.