Anti RSPH14 pAb (ATL-HPA018420)

Atlas Antibodies

Catalog No.: ATL-HPA018420-25

Protein Description: radial spoke head 14 homolog (Chlamydomonas)
Gene Name: RSPH14
Alternative Gene Name: RTDR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000009070: 65%, ENSRNOG00000001315: 69%
Entrez Gene ID: 27156
Uniprot ID: Q9UHP6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD
• Gene Sequence: SLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCMENLKALLKD
• Gene ID - Mouse: ENSMUSG00000009070
• Gene ID - Rat: ENSRNOG00000001315
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.