Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017382-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: RSPH1
Alternative Gene Name: CILD24, FLJ32753, RSP44, RSPH10A, TSGA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024033: 88%, ENSRNOG00000057862: 90%
Entrez Gene ID: 89765
Uniprot ID: Q8WYR4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL |
| Gene Sequence | TAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTL |
| Gene ID - Mouse | ENSMUSG00000024033 |
| Gene ID - Rat | ENSRNOG00000057862 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) | |
| Datasheet | Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) | |
| Datasheet | Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) |
| Citations for Anti RSPH1 pAb (ATL-HPA017382 w/enhanced validation) – 9 Found |
| Shoemark, Amelia; Frost, Emily; Dixon, Mellisa; Ollosson, Sarah; Kilpin, Kate; Patel, Mitali; Scully, Juliet; Rogers, Andrew V; Mitchison, Hannah M; Bush, Andrew; Hogg, Claire. Accuracy of Immunofluorescence in the Diagnosis of Primary Ciliary Dyskinesia. American Journal Of Respiratory And Critical Care Medicine. 2017;196(1):94-101. PubMed |
| Coutton, Charles; Martinez, Guillaume; Kherraf, Zine-Eddine; Amiri-Yekta, Amir; Boguenet, Magalie; Saut, Antoine; He, Xiaojin; Zhang, Feng; Cristou-Kent, Marie; Escoffier, Jessica; Bidart, Marie; Satre, Véronique; Conne, Béatrice; Fourati Ben Mustapha, Selima; Halouani, Lazhar; Marrakchi, Ouafi; Makni, Mounir; Latrous, Habib; Kharouf, Mahmoud; Pernet-Gallay, Karin; Bonhivers, Mélanie; Hennebicq, Sylviane; Rives, Nathalie; Dulioust, Emmanuel; Touré, Aminata; Gourabi, Hamid; Cao, Yunxia; Zouari, Raoudha; Hosseini, Seyedeh Hanieh; Nef, Serge; Thierry-Mieg, Nicolas; Arnoult, Christophe; Ray, Pierre F. Bi-allelic Mutations in ARMC2 Lead to Severe Astheno-Teratozoospermia Due to Sperm Flagellum Malformations in Humans and Mice. American Journal Of Human Genetics. 2019;104(2):331-340. PubMed |
| Kott, Esther; Legendre, Marie; Copin, Bruno; Papon, Jean-François; Dastot-Le Moal, Florence; Montantin, Guy; Duquesnoy, Philippe; Piterboth, William; Amram, Daniel; Bassinet, Laurence; Beucher, Julie; Beydon, Nicole; Deneuville, Eric; Houdouin, Véronique; Journel, Hubert; Just, Jocelyne; Nathan, Nadia; Tamalet, Aline; Collot, Nathalie; Jeanson, Ludovic; Le Gouez, Morgane; Vallette, Benoit; Vojtek, Anne-Marie; Epaud, Ralph; Coste, André; Clement, Annick; Housset, Bruno; Louis, Bruno; Escudier, Estelle; Amselem, Serge. Loss-of-function mutations in RSPH1 cause primary ciliary dyskinesia with central-complex and radial-spoke defects. American Journal Of Human Genetics. 2013;93(3):561-70. PubMed |
| Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. PubMed |
| Jeanson, Ludovic; Copin, Bruno; Papon, Jean-François; Dastot-Le Moal, Florence; Duquesnoy, Philippe; Montantin, Guy; Cadranel, Jacques; Corvol, Harriet; Coste, André; Désir, Julie; Souayah, Anissa; Kott, Esther; Collot, Nathalie; Tissier, Sylvie; Louis, Bruno; Tamalet, Aline; de Blic, Jacques; Clement, Annick; Escudier, Estelle; Amselem, Serge; Legendre, Marie. RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes. American Journal Of Human Genetics. 2015;97(1):153-62. PubMed |
| Tu, Chaofeng; Nie, Hongchuan; Meng, Lanlan; Yuan, Shimin; He, Wenbin; Luo, Aixiang; Li, Haiyu; Li, Wen; Du, Juan; Lu, Guangxiu; Lin, Ge; Tan, Yue-Qiu. Identification of DNAH6 mutations in infertile men with multiple morphological abnormalities of the sperm flagella. Scientific Reports. 2019;9(1):15864. PubMed |
| Tan, Chen; Meng, Lanlan; Lv, Mingrong; He, Xiaojin; Sha, Yanwei; Tang, Dongdong; Tan, Yaqi; Hu, Tongyao; He, Wenbin; Tu, Chaofeng; Nie, Hongchuan; Zhang, Huan; Du, Juan; Lu, Guangxiu; Fan, Li-Qing; Cao, Yunxia; Lin, Ge; Tan, Yue-Qiu. Bi-allelic variants in DNHD1 cause flagellar axoneme defects and asthenoteratozoospermia in humans and mice. American Journal Of Human Genetics. 2022;109(1):157-171. PubMed |
| Wang, Lin; Wang, Rongchun; Yang, Danhui; Lu, Chenyang; Xu, Yingjie; Liu, Ying; Guo, Ting; Lei, Cheng; Luo, Hong. Novel RSPH4A Variants Associated With Primary Ciliary Dyskinesia-Related Infertility in Three Chinese Families. Frontiers In Genetics. 13( 35812741):922287. PubMed |
| Yu, Hui; Shi, Xiao; Shao, Zhongmei; Geng, Hao; Guo, Senzhao; Li, Kuokuo; Gu, Meng; Xu, Chuan; Gao, Yang; Tan, Qing; Duan, Zongliu; Wu, Huan; Hua, Rong; Guo, Rui; Wei, Zhaolian; Zhou, Ping; Cao, Yunxia; He, Xiaojin; Li, Liang; Zhang, Xiaoping; Lv, Mingrong. Novel HYDIN variants associated with male infertility in two Chinese families. Frontiers In Endocrinology. 14( 36742411):1118841. PubMed |