Anti RSAD1 pAb (ATL-HPA022967)

Atlas Antibodies

Catalog No.: ATL-HPA022967-25

Protein Description: radical S-adenosyl methionine domain containing 1
Gene Name: RSAD1
Alternative Gene Name: FLJ11164
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039096: 88%, ENSRNOG00000053680: 27%
Entrez Gene ID: 55316
Uniprot ID: Q9HA92
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSLDDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHC
• Gene Sequence: VTLEANPTSAPGSRLAEFGAAGVNRLSIGLQSLDDTELRLLGRTHSACDALRTLAEARRLFPGRVSVDLMLGLPAQQVGPWLGQLQELLHHC
• Gene ID - Mouse: ENSMUSG00000039096
• Gene ID - Rat: ENSRNOG00000053680
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.