Anti RRP9 pAb (ATL-HPA038798)

Atlas Antibodies

Catalog No.:
ATL-HPA038798-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
Gene Name: RRP9
Alternative Gene Name: RNU3IP2, U3-55K
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041506: 99%, ENSRNOG00000012927: 99%
Entrez Gene ID: 9136
Uniprot ID: O43818
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL
Gene Sequence THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL
Gene ID - Mouse ENSMUSG00000041506
Gene ID - Rat ENSRNOG00000012927
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRP9 pAb (ATL-HPA038798)
Datasheet Anti RRP9 pAb (ATL-HPA038798) Datasheet (External Link)
Vendor Page Anti RRP9 pAb (ATL-HPA038798) at Atlas Antibodies

Documents & Links for Anti RRP9 pAb (ATL-HPA038798)
Datasheet Anti RRP9 pAb (ATL-HPA038798) Datasheet (External Link)
Vendor Page Anti RRP9 pAb (ATL-HPA038798)