Anti RREB1 pAb (ATL-HPA034843)

Atlas Antibodies

Catalog No.:
ATL-HPA034843-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ras responsive element binding protein 1
Gene Name: RREB1
Alternative Gene Name: HNT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039087: 77%, ENSRNOG00000015701: 69%
Entrez Gene ID: 6239
Uniprot ID: Q92766
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF
Gene Sequence GSVPKAATTATPAATTSPKESSEPPAPASSPEAASPTEQGPAGTSKKRGRKRGMRSRPRANSGGVDLDSSGEFASIEKMLATTDTNKFSPF
Gene ID - Mouse ENSMUSG00000039087
Gene ID - Rat ENSRNOG00000015701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RREB1 pAb (ATL-HPA034843)
Datasheet Anti RREB1 pAb (ATL-HPA034843) Datasheet (External Link)
Vendor Page Anti RREB1 pAb (ATL-HPA034843) at Atlas Antibodies

Documents & Links for Anti RREB1 pAb (ATL-HPA034843)
Datasheet Anti RREB1 pAb (ATL-HPA034843) Datasheet (External Link)
Vendor Page Anti RREB1 pAb (ATL-HPA034843)