Anti RRAD pAb (ATL-HPA041755)

Atlas Antibodies

Catalog No.:
ATL-HPA041755-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: Ras-related associated with diabetes
Gene Name: RRAD
Alternative Gene Name: RAD, REM3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031880: 93%, ENSRNOG00000011901: 95%
Entrez Gene ID: 6236
Uniprot ID: P55042
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDK
Gene Sequence VGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLMVYDIWEQDGGRWLPGHCMAMGDAYVIVYSVTDK
Gene ID - Mouse ENSMUSG00000031880
Gene ID - Rat ENSRNOG00000011901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RRAD pAb (ATL-HPA041755)
Datasheet Anti RRAD pAb (ATL-HPA041755) Datasheet (External Link)
Vendor Page Anti RRAD pAb (ATL-HPA041755) at Atlas Antibodies

Documents & Links for Anti RRAD pAb (ATL-HPA041755)
Datasheet Anti RRAD pAb (ATL-HPA041755) Datasheet (External Link)
Vendor Page Anti RRAD pAb (ATL-HPA041755)