Anti RPS6KA3 pAb (ATL-HPA003221)

Atlas Antibodies

Catalog No.: ATL-HPA003221-25

Protein Description: ribosomal protein S6 kinase, 90kDa, polypeptide 3
Gene Name: RPS6KA3
Alternative Gene Name: CLS, HU-3, MRX19, RSK, RSK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031309: 99%, ENSRNOG00000006632: 99%
Entrez Gene ID: 6197
Uniprot ID: P51812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
• Gene Sequence: MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEVSIKEIAITHHVKEGHEKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERDILVEVNHPFIVKLHYAFQTEGKLY
• Gene ID - Mouse: ENSMUSG00000031309
• Gene ID - Rat: ENSRNOG00000006632
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.