Anti RPS6KA1 pAb (ATL-HPA007981 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007981-100

Protein Description: ribosomal protein S6 kinase, 90kDa, polypeptide 1
Gene Name: RPS6KA1
Alternative Gene Name: HU-1, RSK, RSK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003644: 99%, ENSRNOG00000042411: 98%
Entrez Gene ID: 6195
Uniprot ID: Q15418
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
• Gene Sequence: KMLHVDPHQRLTAKQVLQHPWVTQKDKLPQSQLSHQDLQLVKGAMAATYSALNSSKPTPQLKPIESSILAQRRVRKLPSTTL
• Gene ID - Mouse: ENSMUSG00000003644
• Gene ID - Rat: ENSRNOG00000042411
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.