Anti RPS24 pAb (ATL-HPA003364)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003364-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: RPS24
Alternative Gene Name: S24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025290: 100%, ENSRNOG00000010189: 100%
Entrez Gene ID: 6229
Uniprot ID: P62847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK |
| Gene Sequence | TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK |
| Gene ID - Mouse | ENSMUSG00000025290 |
| Gene ID - Rat | ENSRNOG00000010189 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RPS24 pAb (ATL-HPA003364) | |
| Datasheet | Anti RPS24 pAb (ATL-HPA003364) Datasheet (External Link) |
| Vendor Page | Anti RPS24 pAb (ATL-HPA003364) at Atlas Antibodies |
| Documents & Links for Anti RPS24 pAb (ATL-HPA003364) | |
| Datasheet | Anti RPS24 pAb (ATL-HPA003364) Datasheet (External Link) |
| Vendor Page | Anti RPS24 pAb (ATL-HPA003364) |
| Citations for Anti RPS24 pAb (ATL-HPA003364) – 2 Found |
| Badhai, Jitendra; Fröjmark, Anne-Sophie; Razzaghian, Hamid Reza; Davey, Edward; Schuster, Jens; Dahl, Niklas. Posttranscriptional down-regulation of small ribosomal subunit proteins correlates with reduction of 18S rRNA in RPS19 deficiency. Febs Letters. 2009;583(12):2049-53. PubMed |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |