Anti RPS24 pAb (ATL-HPA003364)

Atlas Antibodies

Catalog No.:
ATL-HPA003364-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribosomal protein S24
Gene Name: RPS24
Alternative Gene Name: S24
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025290: 100%, ENSRNOG00000010189: 100%
Entrez Gene ID: 6229
Uniprot ID: P62847
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK
Gene Sequence TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK
Gene ID - Mouse ENSMUSG00000025290
Gene ID - Rat ENSRNOG00000010189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPS24 pAb (ATL-HPA003364)
Datasheet Anti RPS24 pAb (ATL-HPA003364) Datasheet (External Link)
Vendor Page Anti RPS24 pAb (ATL-HPA003364) at Atlas Antibodies

Documents & Links for Anti RPS24 pAb (ATL-HPA003364)
Datasheet Anti RPS24 pAb (ATL-HPA003364) Datasheet (External Link)
Vendor Page Anti RPS24 pAb (ATL-HPA003364)
Citations for Anti RPS24 pAb (ATL-HPA003364) – 2 Found
Badhai, Jitendra; Fröjmark, Anne-Sophie; Razzaghian, Hamid Reza; Davey, Edward; Schuster, Jens; Dahl, Niklas. Posttranscriptional down-regulation of small ribosomal subunit proteins correlates with reduction of 18S rRNA in RPS19 deficiency. Febs Letters. 2009;583(12):2049-53.  PubMed
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed