Anti RPRD1A pAb (ATL-HPA040602 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040602-25

Protein Description: regulation of nuclear pre-mRNA domain containing 1A
Gene Name: RPRD1A
Alternative Gene Name: FLJ10656, HsT3101, P15RS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040446: 98%, ENSRNOG00000016036: 98%
Entrez Gene ID: 55197
Uniprot ID: Q96P16
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
• Gene Sequence: VIVEAFKHVSSETDESCKKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENENCSSLGSPSEPPQTL
• Gene ID - Mouse: ENSMUSG00000040446
• Gene ID - Rat: ENSRNOG00000016036
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPRD1A pAb (ATL-HPA040602 w/enhanced validation) – 1 Found

Ahmad, Yasmeen; Boisvert, Francois-Michel; Lundberg, Emma; Uhlen, Mathias; Lamond, Angus I. Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization. Molecular & Cellular Proteomics : Mcp. 2012;11(3):M111.013680.