Anti RPN2 pAb (ATL-HPA008297)

Atlas Antibodies

Catalog No.: ATL-HPA008297-25

Protein Description: ribophorin II
Gene Name: RPN2
Alternative Gene Name: RIBIIR, RPN-II, RPNII, SWP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027642: 92%, ENSRNOG00000007492: 93%
Entrez Gene ID: 6185
Uniprot ID: P04844
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
• Gene Sequence: SISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTE
• Gene ID - Mouse: ENSMUSG00000027642
• Gene ID - Rat: ENSRNOG00000007492
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPN2 pAb (ATL-HPA008297) – 2 Found

Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. 

Chen, Wei-Shan; Luo, Sheng-Dean; Chiu, Tai-Jan; Wang, Yu-Ming; Chen, Wei-Chih; Chien, Chih-Yen; Fang, Fu-Min; Huang, Tai-Lin; Li, Shau-Hsuan. Ribophorin II Overexpression Is Associated with Poor Response to Induction Chemotherapy with Docetaxel, Cisplatin, and Fluorouracil in P16-Negative Locally Advanced Head and Neck Squamous Cell Carcinoma. Journal Of Clinical Medicine. 2021;10(18)