Anti RPLP0 pAb (ATL-HPA003512)

Atlas Antibodies

Catalog No.: ATL-HPA003512-25

Protein Description: ribosomal protein, large, P0
Gene Name: RPLP0
Alternative Gene Name: L10E, LP0, P0, PRLP0, RPP0
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000067274: 100%, ENSRNOG00000001148: 100%
Entrez Gene ID: 6175
Uniprot ID: P05388
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
• Gene Sequence: VVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRDMLLANKVPAAARAGAIAPCEVTVPAQNTGLGPEKTSFFQALGIT
• Gene ID - Mouse: ENSMUSG00000067274
• Gene ID - Rat: ENSRNOG00000001148
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPLP0 pAb (ATL-HPA003512) – 2 Found

Artero-Castro, Ana; Perez-Alea, Mileidys; Feliciano, Andrea; Leal, Jose A; Genestar, Mónica; Castellvi, Josep; Peg, Vicente; Ramón Y Cajal, Santiago; Lleonart, Matilde E L. Disruption of the ribosomal P complex leads to stress-induced autophagy. Autophagy. 11(9):1499-519. 

Sanada, Noriko; Gotoh-Kinoshita, Yuka; Yamashita, Naoya; Kizu, Ryoichi. An androgen-independent mechanism underlying the androgenic effects of 3-methylcholanthrene, a potent aryl hydrocarbon receptor agonist. Toxicology Research. 2020;9(3):271-282.