Anti RPL3 pAb (ATL-HPA003365)

Atlas Antibodies

Catalog No.: ATL-HPA003365-25

Protein Description: ribosomal protein L3
Gene Name: RPL3
Alternative Gene Name: L3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060036: 96%, ENSRNOG00000016896: 96%
Entrez Gene ID: 6122
Uniprot ID: P39023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
• Gene Sequence: EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
• Gene ID - Mouse: ENSMUSG00000060036
• Gene ID - Rat: ENSRNOG00000016896
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPL3 pAb (ATL-HPA003365) – 2 Found

Badhai, Jitendra; Fröjmark, Anne-Sophie; Razzaghian, Hamid Reza; Davey, Edward; Schuster, Jens; Dahl, Niklas. Posttranscriptional down-regulation of small ribosomal subunit proteins correlates with reduction of 18S rRNA in RPS19 deficiency. Febs Letters. 2009;583(12):2049-53. 

Jäger, Niklas; Ayyub, Shreya Ahana; Korniy, Natalia; Peske, Frank; Hoffmann, Markus; Rodnina, Marina V; Pöhlmann, Stefan. Mutagenic Analysis of the HIV Restriction Factor Shiftless. Viruses. 2022;14(7)