Anti RPL26 pAb (ATL-HPA030449)

Atlas Antibodies

Catalog No.: ATL-HPA030449-100

Protein Description: ribosomal protein L26
Gene Name: RPL26
Alternative Gene Name: L26
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060938: 99%, ENSRNOG00000004214: 99%
Entrez Gene ID: 6154
Uniprot ID: P61254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV
• Gene Sequence: NPFVTSDRSKNRKRHFNAPSHVRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHV
• Gene ID - Mouse: ENSMUSG00000060938
• Gene ID - Rat: ENSRNOG00000004214
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPL26 pAb (ATL-HPA030449) – 1 Found

Kim, Dae-Seok; Camacho, Cristel V; Nagari, Anusha; Malladi, Venkat S; Challa, Sridevi; Kraus, W Lee. Activation of PARP-1 by snoRNAs Controls Ribosome Biogenesis and Cell Growth via the RNA Helicase DDX21. Molecular Cell. 2019;75(6):1270-1285.e14.