Anti RPL10 pAb (ATL-HPA011311)

Atlas Antibodies

Catalog No.: ATL-HPA011311-100

Protein Description: ribosomal protein L10
Gene Name: RPL10
Alternative Gene Name: DXS648, DXS648E, FLJ23544, L10, NOV, QM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058443: 97%, ENSRNOG00000056765: 97%
Entrez Gene ID: 6134
Uniprot ID: P27635
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW
• Gene Sequence: KMSSCAGADRLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPSRGPLDKWW
• Gene ID - Mouse: ENSMUSG00000058443
• Gene ID - Rat: ENSRNOG00000056765
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPL10 pAb (ATL-HPA011311) – 1 Found

Kraushar, Matthew L; Viljetic, Barbara; Wijeratne, H R Sagara; Thompson, Kevin; Jiao, Xinfu; Pike, Jack W; Medvedeva, Vera; Groszer, Matthias; Kiledjian, Megerditch; Hart, Ronald P; Rasin, Mladen-Roko. Thalamic WNT3 Secretion Spatiotemporally Regulates the Neocortical Ribosome Signature and mRNA Translation to Specify Neocortical Cell Subtypes. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2015;35(31):10911-26.