Anti RPH3AL pAb (ATL-HPA024311)

Atlas Antibodies

Catalog No.:
ATL-HPA024311-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: rabphilin 3A-like (without C2 domains)
Gene Name: RPH3AL
Alternative Gene Name: Noc2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020847: 90%, ENSRNOG00000061429: 90%
Entrez Gene ID: 9501
Uniprot ID: Q9UNE2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Gene Sequence QLALRAKLQTGWSVHTYQTEKQRRKQHLSPAEVEAILQVIQRAERLDVLEQQRIGRLVERLETMRRNVMGNG
Gene ID - Mouse ENSMUSG00000020847
Gene ID - Rat ENSRNOG00000061429
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPH3AL pAb (ATL-HPA024311)
Datasheet Anti RPH3AL pAb (ATL-HPA024311) Datasheet (External Link)
Vendor Page Anti RPH3AL pAb (ATL-HPA024311) at Atlas Antibodies

Documents & Links for Anti RPH3AL pAb (ATL-HPA024311)
Datasheet Anti RPH3AL pAb (ATL-HPA024311) Datasheet (External Link)
Vendor Page Anti RPH3AL pAb (ATL-HPA024311)