Anti RPF2 pAb (ATL-HPA035475)

Atlas Antibodies

Catalog No.: ATL-HPA035475-25

Protein Description: ribosome production factor 2 homolog (S. cerevisiae)
Gene Name: RPF2
Alternative Gene Name: bA397G5.4, BXDC1, FLJ21087
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038510: 95%, ENSRNOG00000000587: 93%
Entrez Gene ID: 84154
Uniprot ID: Q9H7B2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK
• Gene Sequence: RSYKLLLKKSGCRTPRIELEEMGPSLDLVLRRTHLASDDLYKLSMKMPKALKPKKKKNISHDTFGTTYGRIHMQKQDLSKLQTRKMKGLKK
• Gene ID - Mouse: ENSMUSG00000038510
• Gene ID - Rat: ENSRNOG00000000587
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RPF2 pAb (ATL-HPA035475) – 1 Found

Samejima, Itaru; Spanos, Christos; Samejima, Kumiko; Rappsilber, Juri; Kustatscher, Georg; Earnshaw, William C. Mapping the invisible chromatin transactions of prophase chromosome remodeling. Molecular Cell. 2022;82(3):696-708.e4.