Anti RPE pAb (ATL-HPA036499)

Atlas Antibodies

Catalog No.:
ATL-HPA036499-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ribulose-5-phosphate-3-epimerase
Gene Name: RPE
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026005: 95%, ENSRNOG00000038085: 95%
Entrez Gene ID: 6120
Uniprot ID: Q96AT9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Gene Sequence VEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKR
Gene ID - Mouse ENSMUSG00000026005
Gene ID - Rat ENSRNOG00000038085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPE pAb (ATL-HPA036499)
Datasheet Anti RPE pAb (ATL-HPA036499) Datasheet (External Link)
Vendor Page Anti RPE pAb (ATL-HPA036499) at Atlas Antibodies

Documents & Links for Anti RPE pAb (ATL-HPA036499)
Datasheet Anti RPE pAb (ATL-HPA036499) Datasheet (External Link)
Vendor Page Anti RPE pAb (ATL-HPA036499)