Anti RPAIN pAb (ATL-HPA031526)

Atlas Antibodies

Catalog No.:
ATL-HPA031526-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: RPA interacting protein
Gene Name: RPAIN
Alternative Gene Name: hRIP, MGC4189, RIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018449: 71%, ENSRNOG00000006913: 73%
Entrez Gene ID: 84268
Uniprot ID: Q86UA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
Gene Sequence MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
Gene ID - Mouse ENSMUSG00000018449
Gene ID - Rat ENSRNOG00000006913
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RPAIN pAb (ATL-HPA031526)
Datasheet Anti RPAIN pAb (ATL-HPA031526) Datasheet (External Link)
Vendor Page Anti RPAIN pAb (ATL-HPA031526) at Atlas Antibodies

Documents & Links for Anti RPAIN pAb (ATL-HPA031526)
Datasheet Anti RPAIN pAb (ATL-HPA031526) Datasheet (External Link)
Vendor Page Anti RPAIN pAb (ATL-HPA031526)