Anti RPAIN pAb (ATL-HPA031526)

Atlas Antibodies

Catalog No.: ATL-HPA031526-25

Protein Description: RPA interacting protein
Gene Name: RPAIN
Alternative Gene Name: hRIP, MGC4189, RIP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018449: 71%, ENSRNOG00000006913: 73%
Entrez Gene ID: 84268
Uniprot ID: Q86UA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
• Gene Sequence: MAESLRSPRRSLYKLVGSPPWKEAFRQRCLERMRNSRDRLLNRYRQAGSSGPGNSQNSFLVQEVMEEEWN
• Gene ID - Mouse: ENSMUSG00000018449
• Gene ID - Rat: ENSRNOG00000006913
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.