Anti RPA2 pAb (ATL-HPA026309 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026309-100

Protein Description: replication protein A2, 32kDa
Gene Name: RPA2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028884: 91%, ENSRNOG00000013005: 91%
Entrez Gene ID: 6118
Uniprot ID: P15927
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTI
• Gene Sequence: WNSGFESYGSSSYGGAGGYTQSPGGFGSPAPSQAEKKSRARAQHIVPCTISQLLSATLVDEVFRIGNVEISQVTI
• Gene ID - Mouse: ENSMUSG00000028884
• Gene ID - Rat: ENSRNOG00000013005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.