Anti ROPN1L pAb (ATL-HPA039193 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039193-25

Protein Description: rhophilin associated tail protein 1-like
Gene Name: ROPN1L
Alternative Gene Name: ASP, FLJ25776, RSPH11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022236: 48%, ENSRNOG00000042781: 47%
Entrez Gene ID: 83853
Uniprot ID: Q96C74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
• Gene Sequence: IPFKTFSYVYRYLARLDSDVSPLETESYLASLKENIDARKNGMIGLSDFFFPKRKLLESIENSEDV
• Gene ID - Mouse: ENSMUSG00000022236
• Gene ID - Rat: ENSRNOG00000042781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ROPN1L pAb (ATL-HPA039193 w/enhanced validation) – 2 Found

Onoufriadis, Alexandros; Shoemark, Amelia; Schmidts, Miriam; Patel, Mitali; Jimenez, Gina; Liu, Hui; Thomas, Biju; Dixon, Mellisa; Hirst, Robert A; Rutman, Andrew; Burgoyne, Thomas; Williams, Christopher; Scully, Juliet; Bolard, Florence; Lafitte, Jean-Jacques; Beales, Philip L; Hogg, Claire; Yang, Pinfen; Chung, Eddie M K; Emes, Richard D; O'Callaghan, Christopher; Bouvagnet, Patrice; Mitchison, Hannah M. Targeted NGS gene panel identifies mutations in RSPH1 causing primary ciliary dyskinesia and a common mechanism for ciliary central pair agenesis due to radial spoke defects. Human Molecular Genetics. 2014;23(13):3362-74. 

Jeanson, Ludovic; Copin, Bruno; Papon, Jean-François; Dastot-Le Moal, Florence; Duquesnoy, Philippe; Montantin, Guy; Cadranel, Jacques; Corvol, Harriet; Coste, André; Désir, Julie; Souayah, Anissa; Kott, Esther; Collot, Nathalie; Tissier, Sylvie; Louis, Bruno; Tamalet, Aline; de Blic, Jacques; Clement, Annick; Escudier, Estelle; Amselem, Serge; Legendre, Marie. RSPH3 Mutations Cause Primary Ciliary Dyskinesia with Central-Complex Defects and a Near Absence of Radial Spokes. American Journal Of Human Genetics. 2015;97(1):153-62.