Anti RNH1 pAb (ATL-HPA039223 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039223-100

Protein Description: ribonuclease/angiogenin inhibitor 1
Gene Name: RNH1
Alternative Gene Name: RAI, RNH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038650: 76%, ENSRNOG00000016416: 76%
Entrez Gene ID: 6050
Uniprot ID: P13489
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT
• Gene Sequence: MSLDIQSLDIQCEELSDARWAELLPLLQQCQVVRLDDCGLTEARCKDISSALRVNPALAELNLRSNELGDVGVHCVLQGLQTPSCKIQKLSLQNCCLT
• Gene ID - Mouse: ENSMUSG00000038650
• Gene ID - Rat: ENSRNOG00000016416
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNH1 pAb (ATL-HPA039223 w/enhanced validation) – 1 Found

Bombaci, Giuseppe; Sarangdhar, Mayuresh Anant; Andina, Nicola; Tardivel, Aubry; Yu, Eric Chi-Wang; Mackie, Gillian M; Pugh, Matthew; Ozan, Vedat Burak; Banz, Yara; Spinetti, Thibaud; Hirzel, Cedric; Youd, Esther; Schefold, Joerg C; Taylor, Graham; Gazdhar, Amiq; Bonadies, Nicolas; Angelillo-Scherrer, Anne; Schneider, Pascal; Maslowski, Kendle M; Allam, Ramanjaneyulu. LRR-protein RNH1 dampens the inflammasome activation and is associated with COVID-19 severity. Life Science Alliance. 2022;5(6)