Anti RNF6 pAb (ATL-HPA040048)

Atlas Antibodies

Catalog No.:
ATL-HPA040048-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein (C3H2C3 type) 6
Gene Name: RNF6
Alternative Gene Name: DKFZp686P0776
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029634: 78%, ENSRNOG00000000968: 71%
Entrez Gene ID: 6049
Uniprot ID: Q9Y252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELRQREGQRFGAAHVWENGARSNVTVRNTNQRLEPIRLRST
Gene Sequence TLGRLRNGIGGAAGIPRANASRTNFSSHTNQSGGSELRQREGQRFGAAHVWENGARSNVTVRNTNQRLEPIRLRST
Gene ID - Mouse ENSMUSG00000029634
Gene ID - Rat ENSRNOG00000000968
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF6 pAb (ATL-HPA040048)
Datasheet Anti RNF6 pAb (ATL-HPA040048) Datasheet (External Link)
Vendor Page Anti RNF6 pAb (ATL-HPA040048) at Atlas Antibodies

Documents & Links for Anti RNF6 pAb (ATL-HPA040048)
Datasheet Anti RNF6 pAb (ATL-HPA040048) Datasheet (External Link)
Vendor Page Anti RNF6 pAb (ATL-HPA040048)