Anti RNF40 pAb (ATL-HPA041330)

Atlas Antibodies

Catalog No.: ATL-HPA041330-25

Protein Description: ring finger protein 40, E3 ubiquitin protein ligase
Gene Name: RNF40
Alternative Gene Name: BRE1B, KIAA0661, RBP95, STARING
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030816: 90%, ENSRNOG00000018840: 91%
Entrez Gene ID: 9810
Uniprot ID: O75150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
• Gene Sequence: AVSRVVEASDRLQRRVEELCQRVYSRGDSEPLSEAAQAHTRELGRENRRLQDLATQLQEKHHRISLEYSELQDKVTSAETKVLEME
• Gene ID - Mouse: ENSMUSG00000030816
• Gene ID - Rat: ENSRNOG00000018840
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF40 pAb (ATL-HPA041330) – 1 Found

Zheng, Xueyong; Chen, Ke; Liu, Xiaolong; Pan, Yu; Liu, Hui. High RNF40 expression indicates poor prognosis of hepatocellular carcinoma. International Journal Of Clinical And Experimental Pathology. 11(5):2901-2906.