Anti RNF25 pAb (ATL-HPA036420)

Atlas Antibodies

Catalog No.:
ATL-HPA036420-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 25
Gene Name: RNF25
Alternative Gene Name: AO7, FLJ13906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026171: 71%, ENSRNOG00000016886: 75%
Entrez Gene ID: 64320
Uniprot ID: Q96BH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR
Gene Sequence ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR
Gene ID - Mouse ENSMUSG00000026171
Gene ID - Rat ENSRNOG00000016886
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF25 pAb (ATL-HPA036420)
Datasheet Anti RNF25 pAb (ATL-HPA036420) Datasheet (External Link)
Vendor Page Anti RNF25 pAb (ATL-HPA036420) at Atlas Antibodies

Documents & Links for Anti RNF25 pAb (ATL-HPA036420)
Datasheet Anti RNF25 pAb (ATL-HPA036420) Datasheet (External Link)
Vendor Page Anti RNF25 pAb (ATL-HPA036420)