Anti RNF25 pAb (ATL-HPA036420)

Atlas Antibodies

Catalog No.: ATL-HPA036420-25

Protein Description: ring finger protein 25
Gene Name: RNF25
Alternative Gene Name: AO7, FLJ13906
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026171: 71%, ENSRNOG00000016886: 75%
Entrez Gene ID: 64320
Uniprot ID: Q96BH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR
• Gene Sequence: ECHAPKGTRDTQELPPPEGPLKEPMDLKPEPHSQGVEGPPQEKGPGSWQGPPPRRTRDCVRWERSKGRTPGSSYPR
• Gene ID - Mouse: ENSMUSG00000026171
• Gene ID - Rat: ENSRNOG00000016886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.