Anti RNF24 pAb (ATL-HPA011900)

Atlas Antibodies

Catalog No.: ATL-HPA011900-25

Protein Description: ring finger protein 24
Gene Name: RNF24
Alternative Gene Name: G1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048911: 99%, ENSRNOG00000023473: 54%
Entrez Gene ID: 11237
Uniprot ID: Q9Y225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRG
• Gene Sequence: IRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRG
• Gene ID - Mouse: ENSMUSG00000048911
• Gene ID - Rat: ENSRNOG00000023473
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.