Anti RNF24 pAb (ATL-HPA011900)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011900-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF24
Alternative Gene Name: G1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048911: 99%, ENSRNOG00000023473: 54%
Entrez Gene ID: 11237
Uniprot ID: Q9Y225
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRG |
| Gene Sequence | IRLRHQAHKEFYAYKQVILKEKVKELNLHELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQLAQLHSKQDRG |
| Gene ID - Mouse | ENSMUSG00000048911 |
| Gene ID - Rat | ENSRNOG00000023473 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF24 pAb (ATL-HPA011900) | |
| Datasheet | Anti RNF24 pAb (ATL-HPA011900) Datasheet (External Link) |
| Vendor Page | Anti RNF24 pAb (ATL-HPA011900) at Atlas Antibodies |
| Documents & Links for Anti RNF24 pAb (ATL-HPA011900) | |
| Datasheet | Anti RNF24 pAb (ATL-HPA011900) Datasheet (External Link) |
| Vendor Page | Anti RNF24 pAb (ATL-HPA011900) |