Anti RNF214 pAb (ATL-HPA039332)

Atlas Antibodies

Catalog No.: ATL-HPA039332-25

Protein Description: ring finger protein 214
Gene Name: RNF214
Alternative Gene Name: DKFZp547C195
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042790: 88%, ENSRNOG00000017151: 93%
Entrez Gene ID: 257160
Uniprot ID: Q8ND24
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTRSLKAGCHTKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLD
• Gene Sequence: VTRSLKAGCHTKQLASRNCSEEKSPQTSILKEGNRDTSLDFRPVVSPANGVEGVRVDQDDDQDSSSLKLSQNIAVQTDFKTADSEVNTDQDIEKNLD
• Gene ID - Mouse: ENSMUSG00000042790
• Gene ID - Rat: ENSRNOG00000017151
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.