Anti RNF2 pAb (ATL-HPA026803)

Atlas Antibodies

Catalog No.: ATL-HPA026803-25

Protein Description: ring finger protein 2
Gene Name: RNF2
Alternative Gene Name: BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026484: 99%, ENSRNOG00000002454: 99%
Entrez Gene ID: 6045
Uniprot ID: Q99496
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELV
• Gene Sequence: ALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELV
• Gene ID - Mouse: ENSMUSG00000026484
• Gene ID - Rat: ENSRNOG00000002454
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RNF2 pAb (ATL-HPA026803) – 1 Found

Kuźbicki, Łukasz; Lange, Dariusz; Stanek-Widera, Agata; Glińska, Agnieszka; Chwirot, Barbara W. Enhanced intratumoral expression of RNF2 is a favorable prognostic factor for patients with cutaneous melanoma?. Oncotarget. 2018;9(25):17656-17663.