Anti RNF175 pAb (ATL-HPA035837)

Atlas Antibodies

Catalog No.:
ATL-HPA035837-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ring finger protein 175
Gene Name: RNF175
Alternative Gene Name: FLJ34190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000004891: 33%, ENSRNOG00000011407: 33%
Entrez Gene ID: 285533
Uniprot ID: Q8N4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHR
Gene Sequence KAAPVLEAPPQQEQLSHTKLSAEDTWNLQQERMYKMHR
Gene ID - Mouse ENSMUSG00000004891
Gene ID - Rat ENSRNOG00000011407
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF175 pAb (ATL-HPA035837)
Datasheet Anti RNF175 pAb (ATL-HPA035837) Datasheet (External Link)
Vendor Page Anti RNF175 pAb (ATL-HPA035837) at Atlas Antibodies

Documents & Links for Anti RNF175 pAb (ATL-HPA035837)
Datasheet Anti RNF175 pAb (ATL-HPA035837) Datasheet (External Link)
Vendor Page Anti RNF175 pAb (ATL-HPA035837)