Anti RNF17 pAb (ATL-HPA039699)

Atlas Antibodies

Catalog No.:
ATL-HPA039699-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: ring finger protein 17
Gene Name: RNF17
Alternative Gene Name: FLJ11045, Mmip-2, SPATA23, TDRD4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000365: 84%, ENSRNOG00000008059: 79%
Entrez Gene ID: 56163
Uniprot ID: Q9BXT8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYEIGYILKDNSQKHIEVWDPSPEEIISNEVHNLNPVSAKSLPNENFQSLYNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEPVK
Gene Sequence SYEIGYILKDNSQKHIEVWDPSPEEIISNEVHNLNPVSAKSLPNENFQSLYNKELPVHICNVISPEKIYVQWLLTENLLNSLEEKMIAAYENSKWEPVK
Gene ID - Mouse ENSMUSG00000000365
Gene ID - Rat ENSRNOG00000008059
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF17 pAb (ATL-HPA039699)
Datasheet Anti RNF17 pAb (ATL-HPA039699) Datasheet (External Link)
Vendor Page Anti RNF17 pAb (ATL-HPA039699) at Atlas Antibodies

Documents & Links for Anti RNF17 pAb (ATL-HPA039699)
Datasheet Anti RNF17 pAb (ATL-HPA039699) Datasheet (External Link)
Vendor Page Anti RNF17 pAb (ATL-HPA039699)