Anti RNF166 pAb (ATL-HPA042970 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042970-25

Protein Description: ring finger protein 166
Gene Name: RNF166
Alternative Gene Name: MGC14381, MGC2647
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014470: 99%, ENSRNOG00000013777: 99%
Entrez Gene ID: 115992
Uniprot ID: Q96A37
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
• Gene Sequence: PCRGCNKKVTLAKMRVHISSCLKVQEQMANCPKFVPVVPTSQPIPSNIPNRSTFACPYCGARNLDQQELVKHCVESHRSDPNRVVCPICSAMP
• Gene ID - Mouse: ENSMUSG00000014470
• Gene ID - Rat: ENSRNOG00000013777
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.