Anti RNF145 pAb (ATL-HPA036562)

Atlas Antibodies

Catalog No.:
ATL-HPA036562-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 145
Gene Name: RNF145
Alternative Gene Name: FLJ31951
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019189: 60%, ENSRNOG00000004602: 60%
Entrez Gene ID: 153830
Uniprot ID: Q96MT1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA
Gene Sequence NSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA
Gene ID - Mouse ENSMUSG00000019189
Gene ID - Rat ENSRNOG00000004602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF145 pAb (ATL-HPA036562)
Datasheet Anti RNF145 pAb (ATL-HPA036562) Datasheet (External Link)
Vendor Page Anti RNF145 pAb (ATL-HPA036562) at Atlas Antibodies

Documents & Links for Anti RNF145 pAb (ATL-HPA036562)
Datasheet Anti RNF145 pAb (ATL-HPA036562) Datasheet (External Link)
Vendor Page Anti RNF145 pAb (ATL-HPA036562)