Anti RNF138 pAb (ATL-HPA041101 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA041101-25

Protein Description: ring finger protein 138, E3 ubiquitin protein ligase
Gene Name: RNF138
Alternative Gene Name: NARF, STRIN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024317: 91%, ENSRNOG00000004120: 78%
Entrez Gene ID: 51444
Uniprot ID: Q8WVD3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR
• Gene Sequence: YCPVCREVLKTPVRTTACQHVFCRKCFLTAMRESGAHCPLCRGNVTRRERACPERALDLENIMRKFSGSCRCCAKQIKFYR
• Gene ID - Mouse: ENSMUSG00000024317
• Gene ID - Rat: ENSRNOG00000004120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.