Anti RNF128 pAb (ATL-HPA019675)

Atlas Antibodies

Catalog No.: ATL-HPA019675-25

Protein Description: ring finger protein 128, E3 ubiquitin protein ligase
Gene Name: RNF128
Alternative Gene Name: FLJ23516, GRAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031438: 91%, ENSRNOG00000055721: 92%
Entrez Gene ID: 79589
Uniprot ID: Q8TEB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA
• Gene Sequence: HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA
• Gene ID - Mouse: ENSMUSG00000031438
• Gene ID - Rat: ENSRNOG00000055721
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.