Anti RNF128 pAb (ATL-HPA019675)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019675-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: RNF128
Alternative Gene Name: FLJ23516, GRAIL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031438: 91%, ENSRNOG00000055721: 92%
Entrez Gene ID: 79589
Uniprot ID: Q8TEB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA |
| Gene Sequence | HKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSLQVPVSNEISNSASSHEEDNRSETASSGYASVQGTDEPPLEEHVQSTNESLQLVNHEANSVAVDVIPHVDNPTFEEDETPNQETA |
| Gene ID - Mouse | ENSMUSG00000031438 |
| Gene ID - Rat | ENSRNOG00000055721 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti RNF128 pAb (ATL-HPA019675) | |
| Datasheet | Anti RNF128 pAb (ATL-HPA019675) Datasheet (External Link) |
| Vendor Page | Anti RNF128 pAb (ATL-HPA019675) at Atlas Antibodies |
| Documents & Links for Anti RNF128 pAb (ATL-HPA019675) | |
| Datasheet | Anti RNF128 pAb (ATL-HPA019675) Datasheet (External Link) |
| Vendor Page | Anti RNF128 pAb (ATL-HPA019675) |