Anti RNF126 pAb (ATL-HPA043050)

Atlas Antibodies

Catalog No.:
ATL-HPA043050-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 126
Gene Name: RNF126
Alternative Gene Name: FLJ20552
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035890: 91%, ENSRNOG00000009028: 90%
Entrez Gene ID: 55658
Uniprot ID: Q9BV68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
Gene Sequence PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
Gene ID - Mouse ENSMUSG00000035890
Gene ID - Rat ENSRNOG00000009028
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF126 pAb (ATL-HPA043050)
Datasheet Anti RNF126 pAb (ATL-HPA043050) Datasheet (External Link)
Vendor Page Anti RNF126 pAb (ATL-HPA043050) at Atlas Antibodies

Documents & Links for Anti RNF126 pAb (ATL-HPA043050)
Datasheet Anti RNF126 pAb (ATL-HPA043050) Datasheet (External Link)
Vendor Page Anti RNF126 pAb (ATL-HPA043050)