Anti RNF126 pAb (ATL-HPA043050)

Atlas Antibodies

Catalog No.: ATL-HPA043050-25

Protein Description: ring finger protein 126
Gene Name: RNF126
Alternative Gene Name: FLJ20552
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035890: 91%, ENSRNOG00000009028: 90%
Entrez Gene ID: 55658
Uniprot ID: Q9BV68
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
• Gene Sequence: PEETRSTENGSAPSTAPTDQSRPPLEHVDQHLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRD
• Gene ID - Mouse: ENSMUSG00000035890
• Gene ID - Rat: ENSRNOG00000009028
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.