Anti RNF122 pAb (ATL-HPA003888)

Atlas Antibodies

Catalog No.:
ATL-HPA003888-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ring finger protein 122
Gene Name: RNF122
Alternative Gene Name: FLJ12526
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039328: 94%, ENSRNOG00000023473: 94%
Entrez Gene ID: 79845
Uniprot ID: Q9H9V4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDEL
Gene Sequence NQAQSERYGYKEVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGILLDEL
Gene ID - Mouse ENSMUSG00000039328
Gene ID - Rat ENSRNOG00000023473
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNF122 pAb (ATL-HPA003888)
Datasheet Anti RNF122 pAb (ATL-HPA003888) Datasheet (External Link)
Vendor Page Anti RNF122 pAb (ATL-HPA003888) at Atlas Antibodies

Documents & Links for Anti RNF122 pAb (ATL-HPA003888)
Datasheet Anti RNF122 pAb (ATL-HPA003888) Datasheet (External Link)
Vendor Page Anti RNF122 pAb (ATL-HPA003888)