Anti RNASEK pAb (ATL-HPA044708)

Atlas Antibodies

Catalog No.:
ATL-HPA044708-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribonuclease, RNase K
Gene Name: RNASEK
Alternative Gene Name: MGC71993
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000093989: 100%, ENSRNOG00000018881: 100%
Entrez Gene ID: 440400
Uniprot ID: Q6P5S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SAVLIEDVPFTEKDFENGPQNIYNLYEQVS
Gene Sequence SAVLIEDVPFTEKDFENGPQNIYNLYEQVS
Gene ID - Mouse ENSMUSG00000093989
Gene ID - Rat ENSRNOG00000018881
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNASEK pAb (ATL-HPA044708)
Datasheet Anti RNASEK pAb (ATL-HPA044708) Datasheet (External Link)
Vendor Page Anti RNASEK pAb (ATL-HPA044708) at Atlas Antibodies

Documents & Links for Anti RNASEK pAb (ATL-HPA044708)
Datasheet Anti RNASEK pAb (ATL-HPA044708) Datasheet (External Link)
Vendor Page Anti RNASEK pAb (ATL-HPA044708)