Anti RNASEH1 pAb (ATL-HPA043037)

Atlas Antibodies

Catalog No.:
ATL-HPA043037-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: ribonuclease H1
Gene Name: RNASEH1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020630: 75%, ENSRNOG00000008584: 73%
Entrez Gene ID: 246243
Uniprot ID: O60930
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL
Gene Sequence RGFGMFYAVRRGRKTGVFLTWNECRAQVDRFPAARFKKFATEDEAWAFVRKSASPEVSEGHENQHGQESEAKASKRL
Gene ID - Mouse ENSMUSG00000020630
Gene ID - Rat ENSRNOG00000008584
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RNASEH1 pAb (ATL-HPA043037)
Datasheet Anti RNASEH1 pAb (ATL-HPA043037) Datasheet (External Link)
Vendor Page Anti RNASEH1 pAb (ATL-HPA043037) at Atlas Antibodies

Documents & Links for Anti RNASEH1 pAb (ATL-HPA043037)
Datasheet Anti RNASEH1 pAb (ATL-HPA043037) Datasheet (External Link)
Vendor Page Anti RNASEH1 pAb (ATL-HPA043037)