Anti RMI2 pAb (ATL-HPA040995 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040995-25

Protein Description: RecQ mediated genome instability 2
Gene Name: RMI2
Alternative Gene Name: BLAP18, C16orf75, MGC24665
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037991: 98%, ENSRNOG00000021902: 96%
Entrez Gene ID: 116028
Uniprot ID: Q96E14
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
• Gene Sequence: GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI
• Gene ID - Mouse: ENSMUSG00000037991
• Gene ID - Rat: ENSRNOG00000021902
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.