Anti RMDN2 pAb (ATL-HPA034705)

Atlas Antibodies

Catalog No.:
ATL-HPA034705-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: regulator of microtubule dynamics 2
Gene Name: RMDN2
Alternative Gene Name: FAM82A, FAM82A1, FLJ32954, RMD2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036368: 75%, ENSRNOG00000006082: 78%
Entrez Gene ID: 151393
Uniprot ID: Q96LZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKK
Gene Sequence SFPVPKAFNTRVEELNLDVLLQKVDHLRMSESGKSESFELLRDHKEKFRDEIEFMWRFARAYGDMYELSTNTQEKK
Gene ID - Mouse ENSMUSG00000036368
Gene ID - Rat ENSRNOG00000006082
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RMDN2 pAb (ATL-HPA034705)
Datasheet Anti RMDN2 pAb (ATL-HPA034705) Datasheet (External Link)
Vendor Page Anti RMDN2 pAb (ATL-HPA034705) at Atlas Antibodies

Documents & Links for Anti RMDN2 pAb (ATL-HPA034705)
Datasheet Anti RMDN2 pAb (ATL-HPA034705) Datasheet (External Link)
Vendor Page Anti RMDN2 pAb (ATL-HPA034705)