Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA043731-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: relaxin 3
Gene Name: RLN3
Alternative Gene Name: H3, RXN3, ZINS4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045232: 88%, ENSRNOG00000005911: 87%
Entrez Gene ID: 117579
Uniprot ID: Q8WXF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
Gene Sequence LALTKSPQAFYRGRPSWQGTPGVLRGSRDVLAGLSSSCCKWGCSKSEISSLC
Gene ID - Mouse ENSMUSG00000045232
Gene ID - Rat ENSRNOG00000005911
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation)
Datasheet Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation)
Datasheet Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti RLN3 pAb (ATL-HPA043731 w/enhanced validation)