Anti RINT1 pAb (ATL-HPA019875)

Atlas Antibodies

Catalog No.:
ATL-HPA019875-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: RAD50 interactor 1
Gene Name: RINT1
Alternative Gene Name: FLJ11785, RINT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028999: 71%, ENSRNOG00000022182: 68%
Entrez Gene ID: 60561
Uniprot ID: Q6NUQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFS
Gene Sequence PCCSESGDERKNLEEKSDINVTVLIGSKQVSEGTDNGDLPSYVSAFIEKEVGNDLKSLKKLDKLIEQRTVSKMQLEEQVLTISSEIPKRIRSALKNAEESKQFLNQFLEQETHLFS
Gene ID - Mouse ENSMUSG00000028999
Gene ID - Rat ENSRNOG00000022182
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RINT1 pAb (ATL-HPA019875)
Datasheet Anti RINT1 pAb (ATL-HPA019875) Datasheet (External Link)
Vendor Page Anti RINT1 pAb (ATL-HPA019875) at Atlas Antibodies

Documents & Links for Anti RINT1 pAb (ATL-HPA019875)
Datasheet Anti RINT1 pAb (ATL-HPA019875) Datasheet (External Link)
Vendor Page Anti RINT1 pAb (ATL-HPA019875)
Citations for Anti RINT1 pAb (ATL-HPA019875) – 2 Found
Zhao, Linbo; Imperiale, Michael J. Identification of Rab18 as an Essential Host Factor for BK Polyomavirus Infection Using a Whole-Genome RNA Interference Screen. Msphere. 2017;2(4)  PubMed
Cousin, Margot A; Conboy, Erin; Wang, Jian-She; Lenz, Dominic; Schwab, Tanya L; Williams, Monique; Abraham, Roshini S; Barnett, Sarah; El-Youssef, Mounif; Graham, Rondell P; Gutierrez Sanchez, Luz Helena; Hasadsri, Linda; Hoffmann, Georg F; Hull, Nathan C; Kopajtich, Robert; Kovacs-Nagy, Reka; Li, Jia-Qi; Marx-Berger, Daniela; McLin, Valérie; McNiven, Mark A; Mounajjed, Taofic; Prokisch, Holger; Rymen, Daisy; Schulze, Ryan J; Staufner, Christian; Yang, Ye; Clark, Karl J; Lanpher, Brendan C; Klee, Eric W. RINT1 Bi-allelic Variations Cause Infantile-Onset Recurrent Acute Liver Failure and Skeletal Abnormalities. American Journal Of Human Genetics. 2019;105(1):108-121.  PubMed