Anti RINL pAb (ATL-HPA042083)

Atlas Antibodies

Catalog No.:
ATL-HPA042083-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: Ras and Rab interactor-like
Gene Name: RINL
Alternative Gene Name: FLJ45909
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051735: 66%, ENSRNOG00000025354: 63%
Entrez Gene ID: 126432
Uniprot ID: Q6ZS11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RDVLPRTLLLPPPTLGPRDEHTDPVQIGRVQQDTPGKVLSIVNQLYLETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLS
Gene Sequence RDVLPRTLLLPPPTLGPRDEHTDPVQIGRVQQDTPGKVLSIVNQLYLETHRGWGREQTPQETEPEAAQRHDPAPRNPAPHGVSWVKGPLS
Gene ID - Mouse ENSMUSG00000051735
Gene ID - Rat ENSRNOG00000025354
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti RINL pAb (ATL-HPA042083)
Datasheet Anti RINL pAb (ATL-HPA042083) Datasheet (External Link)
Vendor Page Anti RINL pAb (ATL-HPA042083) at Atlas Antibodies

Documents & Links for Anti RINL pAb (ATL-HPA042083)
Datasheet Anti RINL pAb (ATL-HPA042083) Datasheet (External Link)
Vendor Page Anti RINL pAb (ATL-HPA042083)