Anti RIMBP2 pAb (ATL-HPA044114)

Atlas Antibodies

Catalog No.: ATL-HPA044114-25

Protein Description: RIMS binding protein 2
Gene Name: RIMBP2
Alternative Gene Name: KIAA0318, MGC15831, PPP1R133, RBP2, RIM-BP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029420: 95%, ENSRNOG00000022893: 95%
Entrez Gene ID: 23504
Uniprot ID: O15034
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLP
• Gene Sequence: RVDNITQISAQLSWLPTNSNYSHVIFLNEEEFDIVKAARYKYQFFNLRPNMAYKVKVLAKPHQMPWQLPLEQREKKEAFVEFSTLP
• Gene ID - Mouse: ENSMUSG00000029420
• Gene ID - Rat: ENSRNOG00000022893
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.