Anti RILPL1 pAb (ATL-HPA041314)

Atlas Antibodies

Catalog No.: ATL-HPA041314-25

Protein Description: Rab interacting lysosomal protein-like 1
Gene Name: RILPL1
Alternative Gene Name: FLJ39378
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029392: 94%, ENSRNOG00000001055: 94%
Entrez Gene ID: 353116
Uniprot ID: Q5EBL4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV
• Gene Sequence: LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV
• Gene ID - Mouse: ENSMUSG00000029392
• Gene ID - Rat: ENSRNOG00000001055
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti RILPL1 pAb (ATL-HPA041314) – 2 Found

Li, Amy; Ponten, Fredrik; dos Remedios, Cristobal G. The interactome of LIM domain proteins: the contributions of LIM domain proteins to heart failure and heart development. Proteomics. 2012;12(2):203-25. 

Schaub, Johanna R; Stearns, Tim. The Rilp-like proteins Rilpl1 and Rilpl2 regulate ciliary membrane content. Molecular Biology Of The Cell. 2013;24(4):453-64.